General Information

  • ID:  hor002920
  • Uniprot ID:  P21786
  • Protein name:  Allatotropin
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  NA
  • Source:  animal
  • Expression:  In the 5th instar larva isoform 1 is induced in the nerve cord by starvation, ingestion of the ecdysteroid agonist RH-5992 or parasitization with C.congregata. |Detected in the day 2 fifth-instar larva, wandering larva, pupa and adult. |Expressed extensiv
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0002027 regulation of heart rate; GO:0006811 monoatomic ion transport; GO:0007218 neuropeptide signaling pathway; GO:0043271 negative regulation of monoatomic ion transport; GO:0045969 positive regulation of juvenile hormone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GFKNVEMMTARGF
  • Length:  13(37-49)
  • Propeptide:  MNLTMQLAVIVAVCLCLAEGAPDVRLTRTKQQRPTRGFKNVEMMTARGFGKRDRPHPRAERDVDHQAPSARPNRGTPTFKSPTVGIARDFGKRASQYGNEEEIRVTRGTFKPNSNILIARGYGKRTQLPQIDGVYGLDNFWEMLETSPEREVQEVDEKTLESIPLDWFVNEMLNNPDFARSVVRKFIDLNQDGMLSSEELLRNF
  • Signal peptide:  MNLTMQLAVIVAVCLCLAEG
  • Modification:  T13 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide stimulator of juvenile hormone synthesis. Cardioregulatory neurohormone that increases heart beat rate in the adult but not in the larva. Inhibits active ion transport in the midgut of feeding fourth instar and day 2 fifth instar larva, but n
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P63312-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P63312-F1.pdbhor002920_AF2.pdbhor002920_ESM.pdb

Physical Information

Mass: 170197 Formula: C65H102N18O18S2
Absent amino acids: CDHILPQSWY Common amino acids: FGM
pI: 9.69 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -11.54 Boman Index: -1810
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 30
Instability Index: -1329.23 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17839751
  • Title:  Identification of an allatotropin from adult Manduca Sexta.
  • PubMed ID:  7964382
  • Title:  Allatotropin Is a Cardioacceleratory Peptide in Manduca Sexta.
  • PubMed ID:  9787126
  • Title:  Inhibition of Midgut Ion Transport by Allatotropin (Mas-AT) and Manduca FLRFamides in the Tobacco Hornworm Manduca Sexta.